PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK25283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 70aa    MW: 8486.23 Da    PI: 10.1075
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK25283.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.6e-19247147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l ++v+q+G  +W++Ia+++  gR++k+c++rw++ 
        PK25283.1  2 RGHWRPAEDEKLRQLVEQYGAQNWNSIAEKLH-GRSGKSCRLRWFNQ 47
                     899*****************************.***********996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.2E-14150IPR001005SANT/Myb domain
PROSITE profilePS5129426.599152IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.2E-29366IPR009057Homeodomain-like
SuperFamilySSF466891.12E-20369IPR009057Homeodomain-like
CDDcd001671.46E-12546No hitNo description
PfamPF139216.7E-19565No hitNo description
PROSITE profilePS512947.3385370IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
XRGHWRPAED EKLRQLVEQY GAQNWNSIAE KLHGRSGKSC RLRWFNQLDP RINRRPFTEE  60
EEERLLAAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-16270775B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019337.15e-43Myb domain protein 52
SwissprotQ9FDW19e-23MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A061FIQ06e-43A0A061FIQ0_THECC; Myb domain protein 52
STRINGGLYMA04G42110.23e-42(Glycine max)
STRINGGLYMA06G12691.13e-42(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.16e-37myb domain protein 52